PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr001350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 288aa    MW: 32636.1 Da    PI: 6.0674
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr001350.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.75.5e-131459146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+WT+eEde l++ vk+ G+++W+ I ++  + Rt+k+c++rw +
      Pbr001350.1 14 KGPWTAEEDEVLINHVKRNGPRDWSFIRSKGLLPRTGKSCRLRWVN 59
                     79*************************8876677**********87 PP

2Myb_DNA-binding44.24.5e-1470111346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++++eE+   +++ +q+G++ W++Ia++++ gRt++++k++w +
      Pbr001350.1  70 KFSAEEERMVIQLQAQFGNK-WAKIAAYLQ-GRTDNDVKNFWST 111
                      79******************.*********.***********65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.442961IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-191062IPR009057Homeodomain-like
SuperFamilySSF466894.12E-2812109IPR009057Homeodomain-like
SMARTSM007172.7E-111363IPR001005SANT/Myb domain
CDDcd001671.47E-111661No hitNo description
PfamPF139212.0E-111767No hitNo description
PROSITE profilePS5129420.62462117IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-1863115IPR009057Homeodomain-like
SMARTSM007172.4E-1267115IPR001005SANT/Myb domain
CDDcd001671.01E-1070109No hitNo description
PfamPF002491.1E-1270110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MARQKQNDGA YIRKGPWTAE EDEVLINHVK RNGPRDWSFI RSKGLLPRTG KSCRLRWVNK  60
LRPNLKTGCK FSAEEERMVI QLQAQFGNKW AKIAAYLQGR TDNDVKNFWS TRRKRFERIL  120
QKSTSSNSPK NKGKSLVHHE FPVDKVSSHP SNSFLNSEEL GMVDLPDLVK ANQLLNVEAE  180
QQPMLEATPI NMIPSSDFPP HLSLSQLPQS QLDLSFLSGC KEIDQDPIVL NLLDMFGEEI  240
PPLGLEENAQ GNKLGELKDL STPDIFFDEF PPEMLDYLET LTSSSEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-261411527126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009362802.10.0PREDICTED: transcription factor MYB21-like
TrEMBLM5X8811e-138M5X881_PRUPE; Uncharacterized protein
STRINGGLYMA12G37026.12e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.13e-64MYB family protein